Skip to the beginning of the images gallery

Recombinant Human KGF Protein, CAS No.148348-15-6

Grade & Purity:

≥95%(SDS-PAGE)

Expression System: Oryza sativa
Accession #: P21781.1
Protein Tag: No tag
Bioactivity: Measured in a cell proliferation assay using MCF7 breast cancer cell line. The ED₅₀ for this effect is typically <10 ng/mL.
Endotoxin Concentration: <0.1 EU/μg

In stock

Item Number

rp155960

Grouped product items
SKU	Size	Availability	Price
rp155960-10μg	10μg	1	$189.90
rp155960-50μg	50μg	1	$619.90
rp155960-100μg	100μg	2	$999.90
rp155960-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$4,599.90

GMP, ≥95% (SDS-PAGE), Active, Oryza sativa, No tag, 32-194 aa

View related series

Click to view protein information: FGF7

Accession#:P21781 (5) FGF7 (5) Gene ID:2252 (5) KGF (5)

Basic Description

Product Name	Recombinant Human KGF Protein, CAS No.148348-15-6
Synonyms	FGF7 \| FGF-7 \| fibroblast growth factor 7HBGF-7 \| HBGF7 \| HBGF-7 \| Heparin-binding growth factor 7 \| keratinocyte growth factor \| KGF \| KGFfibroblast growth factor 7 (keratinocyte growth factor)
Grade	ActiBioPure™, Azide Free, Bioactive, Carrier Free, GMP, High Performance
Product Description	Keratinocyte growth factor (KGF) is a cytokine found by Rubin et al. (1989) from the culture supernatant of embryonic lung fibroblasts, which is a member of the FGF family, namely FGF-7. KGF is an effective epithelial-specific growth factor secreted by mesenchymal cells and distributed in epithelial cells. Its mitotic activity is mainly manifested in keratinocytes, which can specifically promote the proliferation, migration and differentiation of epithelial cells. It is closely related to organ development, wound repair, tumor genesis and immune reconstruction. Activity definition: The ED50 value is less than 1.0 ng/ml, that is, the corresponding activity unit is greater than or equal to 1 x 10*6 units/mg, as determined by the proliferation method of cultured MCF-7 cells.
Specifications & Purity	ActiBioPure™, Bioactive, GMP, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE)
Bioactivity	Measured in a cell proliferation assay using MCF7 breast cancer cell line. The ED₅₀ for this effect is typically <10 ng/mL.
Endotoxin Concentration	<0.1 EU/μg
Expression System	Oryza sativa
Species	Human
Amino Acids	32-194 aa
Sequence	MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLP MAIT
Protein Tag	No tag
Accession #	P21781.1
Source	Rice seed
Predicted molecular weight	19.0 kD

Storage and Shipping

Shape	Lyophilized
Reconstitution	It is recommended to re dissolve OsrhKGF freeze-dried powder to 100-200 ug/ml with sterile water, and further dilute it with other solvents. The dissolved OsrhKGF can be stored for 2-7 days at 4 ℃ and used up as soon as possible. If it is not used for a short time, please store it at - 20 ℃. After opening, please use it as soon as possible to avoid pollution.
Storage Temp	Store at -20°C
Shipped In	Ice chest + Ice pads
Stability And Storage	Shipped at 4°C. Store at +4°C short term (2-7 days). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. Resolution: It is recommended to redissolve lyophilized powder with sterile water to 100-200 ug/ml, and further dilute it with other so
CAS	148348-15-6

Images

Protein Bioactivity: Recombinant Human KGF Protein (rp155960)

Recombinant Human KGF Protein (rp155960)-Protein Bioactivity
Measured in a cell proliferation assay using MCF7 breast cancer cell line. The ED₅₀ for this effect is typically <10ng/mL.

SDS-PAGE: Recombinant Human KGF Protein (rp155960)

Recombinant Human KGF Protein (rp155960)-SDS-PAGE
2μg/lane of Recombinant Human KGF was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16kDa. Another band is the HSA protein.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ23F0300075	Certificate of Analysis	Mar 25, 2023	rp155960
ZJ23F0300079	Certificate of Analysis	Mar 25, 2023	rp155960
ZJ23F0300074	Certificate of Analysis	Mar 25, 2023	rp155960

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration