Skip to the beginning of the images gallery

Recombinant Human KGF/FGF-7 Protein, ＞90% (SDS-PAGE), high purity

Grade & Purity:

≥90%(SDS-PAGE)

Expression System: E. coli
Accession #: P21781
Protein Tag: No tag
Bioactivity: Measured in a cell proliferation assay using MCF-7. The ED50 for this effect is typically ＜2.0 ng/mL.
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp156342

Grouped product items
SKU	Size	Availability	Price
rp156342-10μg	10μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$189.90
rp156342-50μg	50μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$619.90
rp156342-100μg	100μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$999.90
rp156342-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$4,599.90

Carrier Free, >90% (SDS-PAGE), E.coli, No tag, 32-194 aa

View related series

Click to view protein information: FGF7

Accession#:P21781 (5) FGF7 (5) Gene ID:2252 (5) KGF (5)

Basic Description

Product Name	Recombinant Human KGF/FGF-7 Protein, ＞90% (SDS-PAGE), high purity
Synonyms	FGF7 \| Fibroblast growth factor 7 \| FGF-7 \| HBGF-7 \| HBGF7 \| Heparin-binding growth factor 7 \| Keratinocyte growth factor \| KGF \| FGF-7 \| HBGF-7 \| Heparin-binding growth factor 7 \| Keratinocyte growth factor
Grade	ActiBioPure™, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Purity: >90%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： KGF (keratinocyte growth factor), also known as FGF-7 (fibroblast growth factor-7), is one of 22 known members of the mouse FGF family of secreted proteins that plays a key role in development, morphogenesis, angiogenesis, wound healing, and tumorigenesis (1-4). KGF expression is restricted to cells of mesenchymal origin. When secreted, it acts as a paracrine growth factor for nearby epithelial cells (1). KGF speeds wound healing by being dramatically upregulated in response to damage to skin or internal structures that results in high local concentrations of inflammatory mediators such as IL-1 and TNF-alpha. (2, 5). KGF promotes cell migration and invasion, and mediates melanocyte transfer to keratinocytes upon UVB radiation (6, 7). It has been used ectopically to avoid chemotherapy-induced oral mucositis in patients with hematological malignancies (1). Deletion of KGF affects kidney development, producing abnormally small ureteric buds and fewer nephrons (8). It also impedes hair follicle differentiation (9). The 194 amino acid (aa) KGF precursor contains a 31 aa signal sequence and, like all other FGFs, an ~120 aa beta -trefoil scaffold that includes receptor- and heparin-binding sites. KGF signals only through the IIIb splice form of the tyrosine kinase receptor, FGF R2 (FGF R2-IIIb/KGF R) (10). Receptor dimerization requires an octameric or larger heparin or heparin sulfate proteoglycan (11). FGF-10, also called KGF2, shares 51% aa identity and similar function to KGF, but shows more limited expression than KGF and uses an additional receptor, FGF R2-IIIc (12). Following receptor engagement, KGF is typically degraded, while FGF-10 is recycled (12). Mature human KGF, which is active across species, shares 98% aa sequence identity with bovine, equine, ovine and canine, 96% with mouse and porcine, and 92% with rat KGF, respectively.
Specifications & Purity	Carrier Free, Azide Free, Bioactive, ActiBioPure™, High performance, ≥90%(SDS-PAGE)
Purity	＞90% (SDS-PAGE)
Bioactivity	Measured in a cell proliferation assay using MCF-7. The ED50 for this effect is typically ＜2.0 ng/mL.
Endotoxin Concentration	<1.0 EU/μg
Expression System	E. coli
Species	Human
Amino Acids	32-194 aa
Sequence	CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Protein Tag	No tag
Accession #	P21781
Predicted molecular weight	18.97 kDa
SDS-PAGE	18.4 kDa, reducing conditions; 17.4 kDa, non-reducing conditions

Storage and Shipping

Shape	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle.

Images

Protein Bioactivity: Recombinant Human KGF/FGF-7 Protein (rp156342)

Recombinant Human KGF/FGF-7 Protein (rp156342) - Protein Bioactivity
Measured in a cell proliferation assay using MCF-7 cells. The ED₅₀ for this effect is typically < 2.0 ng/mL.

SDS-PAGE: Recombinant Human KGF/FGF-7 Protein (rp156342)

Recombinant Human KGF/FGF-7 Protein (rp156342) - SDS-PAGE
3 μg/lane of Recombinant Human KGF FGF-7 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing a band at 18.4 kDa under reducing conditions and 17.4 kDa under non-reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ23F0700651	Certificate of Analysis	Jul 21, 2023	rp156342
ZJ23F0700650	Certificate of Analysis	Jul 20, 2023	rp156342
ZJ23F0700649	Certificate of Analysis	Jul 20, 2023	rp156342

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration