Skip to the beginning of the images gallery

Recombinant Human Erythropoietin/EPO Protein, >95% (SDS-PAGE), high purity

Grade & Purity:

≥95%(SDS-PAGE)
See COA

Expression System: HEK293
Accession #: P01588
Protein Tag: C-His
Bioactivity: Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.27 ng/mL.
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp156337

Grouped product items
SKU	Size	Availability	Price
rp156337-10μg	10μg	≥10	$89.90
rp156337-50μg	50μg	10	$259.90
rp156337-100μg	100μg	3	$399.90
rp156337-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$1,499.90

Animal Free, >95% (SDS-PAGE), Active, 293F cell, His tag, 28-193 aa

View related series

Click to view protein information: EPO

Accession#:P01588 (2) EPO (3) Erythropoietin/EPO (1) Gene ID:2056 (2)

Basic Description

Product Name	Recombinant Human Erythropoietin/EPO Protein, >95% (SDS-PAGE), high purity
Synonyms	EP \| EPO \| EPO alpha \| Epoetin \| Erythropoetin \| Erythropoietin precursor \| MVCD2
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining Description: Human erythropoietin is member of the EPO/TPO family and encodes a secreted, glycosylated cytokine hormone composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. It is produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
Specifications & Purity	Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, ≥95%(SDS-PAGE), See COA
Purity	>95% (SDS-PAGE)
Bioactivity	Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.27 ng/mL.
Endotoxin Concentration	<1.0 EU/μg
Expression System	HEK293
Amino Acids	28-193 aa
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDRENLYFQSHHHHHH
Protein Tag	C-His
Accession #	P01588
Predicted molecular weight	20.1 kDa
SDS-PAGE	37.6 kDa, under reducing condition; 37.1 kDa, under non-reducing condition

Storage and Shipping

Shape	Lyophilized
Concentration	See COA
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Images

Protein Bioactivity: Recombinant Human EPO Protein (rp156337)

Recombinant Human EPO Protein (rp156337) - Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is 0.27 ng/mL.

SDS-PAGE: Recombinant Human EPO Protein (rp156337)

Recombinant Human EPO Protein (rp156337) - SDS-PAGE
3 μg/lane of Recombinant Human EPO Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 37.6 kDa under reducing conditions and 37.1 kDa under non-reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0303304	Certificate of Analysis	Mar 22, 2024	rp156337
ZJ24F0303303	Certificate of Analysis	Mar 22, 2024	rp156337
ZJ24F0303305	Certificate of Analysis	Mar 22, 2024	rp156337
ZJ24R0300317	Certificate of Analysis	Mar 08, 2024	rp156337

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration