Skip to the beginning of the images gallery

Recombinant Human BCMA/TNFRSF17 Protein

Grade & Purity:

≥90%(SDS-PAGE)

Expression System: HEK293
Accession #: Q6PE46
Protein Tag: C-Fc
Bioactivity: Immobilized Recombinant Human BCMA/TNFRSF17 Protein (rp169554) at 0.5 μg/mL can bind Belantamab (anti-TNFRSF17) (Ab170526) with the EC50 of 22.0 ng/mL.
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp169554

Grouped product items
SKU	Size	Availability	Price
rp169554-10μg	10μg	≥10	$69.90
rp169554-50μg	50μg	10	$219.90
rp169554-100μg	100μg	10	$339.90
rp169554-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,599.90

Animal Free, ≥90% (SDS-PAGE), Active, 293F cell, C-Fc tag, 1-54 aa

View related series

Click to view protein information: TNFRSF17

Accession#: Q6PE46 (1) BCMA (5) BCMA/TNFRSF17 (1) Gene ID:608 (7) TNFRSF17 (7)

Basic Description

Product Name	Recombinant Human BCMA/TNFRSF17 Protein
Synonyms	B cell maturation antigen \| B-cell maturation protein \| BCMA \| BCMAtumor necrosis factor receptor superfamily member 17 \| BCMB-cell maturation factor \| CD269 antigen \| CD269 \| TNFRSF13A \| TNFRSF17 \| tumor necrosis factor receptor superfamily, member 17,
Grade	ActiBioPure™, Animal Free, Bioactive, Carrier Free
Product Description	Protein Function: BCMA, B cell maturation antigen, is a member of the TNF receptor superfamily. It has been designated TNFRSF17. BCMA is a type III membrane protein containing one extracellular cysteine rich domain. Within the TNFRSF, it shares the highest homology with TACI. BCMA and TACI have both been shown to bind to APRIL and BAFF, members of the TNF ligand superfamily. BCMA expression has been found in immune organs and mature B cell lines. Although some expression has been observed at the cell surface, BCMA appears to be localized to the Golgi compartment. The binding of BCMA to APRIL or BAFF has been shown to stimulate IgM production in peripheral blood B cells and increase the survival of cultured B cells. This data suggests that BCMA may play an important role in B cell development, function and regulation. Human BCMA is a 184 amino acid (aa) protein consisting of a 54 aa extracellular domain, a 23 aa transmembrane domain, and a 107 aa intracellular domain. Mouse and human BCMA share 62% amino acid identity.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥90%(SDS-PAGE)
Bioactivity	Immobilized Recombinant Human BCMA/TNFRSF17 Protein (rp169554) at 0.5 μg/mL can bind Belantamab (anti-TNFRSF17) (Ab170526) with the EC50 of 22.0 ng/mL.
Endotoxin Concentration	<1.0 EU/μg
Expression System	HEK293
Amino Acids	1-54 aa
Sequence	MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Protein Tag	C-Fc
Accession #	Q6PE46
Predicted molecular weight	34.3 kDa
SDS-PAGE	34.0-44.3 kDa, under reducing conditions; 57.0-90.2 kDa, under non-reducing conditions

Storage and Shipping

Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

ELISA: Recombinant Human BCMA/TNFRSF17 Protein (rp169554)

Recombinant Human BCMA/TNFRSF17 Protein (rp169554) - ELISA
Immobilized Recombinant Human BCMA/TNFRSF17 Protein (rp169554) at 0.5 μg/mL can bind Belantamab (anti-TNFRSF17) (Ab170526) with the EC50 of 22.0 ng/mL.

SDS-PAGE: Recombinant Human BCMA/TNFRSF17 Protein (rp169554)

Recombinant Human BCMA/TNFRSF17 Protein (rp169554) - SDS-PAGE
3 μg/lane of Recombinant Human BCMA/TNFRSF17 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 34.0-44.3 kDa under reducing conditions and 57.0-90.2 kDa under non-reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0707636	Certificate of Analysis	Jul 03, 2024	rp169554
ZJ24F0707635	Certificate of Analysis	Jul 03, 2024	rp169554
ZJ24F0707634	Certificate of Analysis	Jul 03, 2024	rp169554
ZJ24R0600640	Certificate of Analysis	Jun 10, 2024	rp169554

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration