The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
PRLR
| Description |
Prolactin receptor
|
Gene and Protein Information
| Gene ID |
5618
|
| Uniprot Accession IDs |
P16471
B2R882
D1MDP1
Q16354
Q8TD75
Q8TD78
Q96P35
Q96P36
Q9BX87
Q9UHJ5
PRL-R
|
| Ensembl ID |
ENSG00000113494
|
| Symbol |
HPRL
MFAB
hPRLrI
RI-PRLR
|
| Chromosome |
5
|
| Family |
Belongs to the type I cytokine receptor family. Type 1 subfamily. |
| Sequence |
MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH
Show more
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Macaque |
699369 |
PRLR |
prolactin receptor |
9544 |
|
Inparanoid, OMA |
| Mouse |
19116 |
Prlr |
prolactin receptor |
10090 |
MGI:97763 |
Inparanoid, OMA |
| Rat |
24684 |
Prlr |
prolactin receptor |
10116 |
RGD:3407 |
Inparanoid, OMA |
| Dog |
479363 |
PRLR |
prolactin receptor |
9615 |
VGNC:44994 |
Inparanoid, OMA |
| Horse |
100053793 |
PRLR |
prolactin receptor |
9796 |
VGNC:21857 |
Inparanoid, OMA |
| Cow |
281422 |
PRLR |
prolactin receptor |
9913 |
VGNC:33346 |
Inparanoid, OMA |
| Pig |
414916 |
PRLR |
prolactin receptor |
9823 |
|
Inparanoid, OMA |
| Opossum |
100014991 |
PRLR |
prolactin receptor |
13616 |
|
Inparanoid, OMA |
| Anole lizard |
100565189 |
prlr |
prolactin receptor |
28377 |
|
Inparanoid, OMA |
| Xenopus |
100491566 |
prlr |
prolactin receptor |
8364 |
XB-GENE-494789 |
Inparanoid, OMA |
| Zebrafish |
407651 |
prlra |
prolactin receptor a |
7955 |
ZDB-GENE-080103-2 |
Inparanoid, OMA |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.