JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

EPO

Description	Erythropoietin

Gene and Protein Information

Gene ID	2056
Uniprot Accession IDs	P01588 Q2M2L6 Q549U2 Q9UDZ0 Q9UEZ5 Q9UHA0
Ensembl ID	ENSG00000130427
Symbol	EP DBAL ECYT5 MVCD2
Chromosome	7
Family	Belongs to the EPO/TPO family.
Sequence	MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	463609	EPO	erythropoietin	9598	VGNC:4340	OMA, EggNOG
Macaque	719294	EPO	erythropoietin	9544		Inparanoid, OMA, EggNOG
Mouse	13856	Epo	erythropoietin	10090	MGI:95407	Inparanoid, OMA, EggNOG
Rat	24335	Epo	erythropoietin	10116	RGD:2559	Inparanoid, OMA, EggNOG
Dog	404002	EPO	erythropoietin	9615	VGNC:40422	Inparanoid, OMA, EggNOG
Horse	100033849	EPO	erythropoietin	9796	VGNC:51127	Inparanoid, OMA, EggNOG
Cow	280784	EPO	erythropoietin	9913	VGNC:28549	Inparanoid, OMA, EggNOG
Pig	397249	EPO	erythropoietin	9823		Inparanoid, OMA, EggNOG
Opossum		EPO	erythropoietin [Source:HGNC Symbol;Acc:HGNC:3415]	13616		Inparanoid, OMA, EggNOG
Zebrafish	100004455	epoa	erythropoietin a	7955	ZDB-GENE-061218-3	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.