The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
SIGMAR1
| Description |
Sigma non-opioid intracellular receptor 1
|
Gene and Protein Information
| Gene ID |
10280
|
| Uniprot Accession IDs |
Q99720
D3DRM7
O00673
O00725
Q0Z9W6
Q153Z1
Q2TSD1
Q53GN2
Q7Z653
Q8N7H3
Q9NYX0
|
| Ensembl ID |
ENSG00000147955
|
| Symbol |
OPRS1
SRBP
SRBP
ALS16
DSMA2
OPRS1
SR-BP
SIG-1R
SR-BP1
sigma1R
hSigmaR1
|
| Chromosome |
9
|
| Family |
Belongs to the ERG2 family. |
| Sequence |
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
465062 |
SIGMAR1 |
sigma non-opioid intracellular receptor 1 |
9598 |
VGNC:10120 |
OMA, EggNOG |
| Macaque |
700469 |
SIGMAR1 |
sigma non-opioid intracellular receptor 1 |
9544 |
|
Inparanoid, OMA, EggNOG |
| Mouse |
18391 |
Sigmar1 |
sigma non-opioid intracellular receptor 1 |
10090 |
MGI:1195268 |
Inparanoid, OMA, EggNOG |
| Rat |
29336 |
Sigmar1 |
sigma non-opioid intracellular receptor 1 |
10116 |
RGD:68364 |
Inparanoid, OMA, EggNOG |
| Dog |
481587 |
SIGMAR1 |
sigma non-opioid intracellular receptor 1 |
9615 |
VGNC:46170 |
Inparanoid, OMA, EggNOG |
| Horse |
|
SIGMAR1 |
sigma non-opioid intracellular receptor 1 [Source:HGNC Symbol;Acc:HGNC:8157] |
9796 |
|
OMA, EggNOG |
| Cow |
538903 |
SIGMAR1 |
sigma non-opioid intracellular receptor 1 |
9913 |
VGNC:34619 |
Inparanoid, OMA, EggNOG |
| Opossum |
100028812 |
SIGMAR1 |
sigma non-opioid intracellular receptor 1 |
13616 |
|
Inparanoid, OMA, EggNOG |
| Chicken |
100859748 |
SIGMAR1 |
sigma non-opioid intracellular receptor 1 |
9031 |
CGNC:63401 |
Inparanoid, OMA |
| Anole lizard |
100551557 |
sigmar1 |
sigma non-opioid intracellular receptor 1 |
28377 |
|
Inparanoid, OMA, EggNOG |
| Zebrafish |
393952 |
sigmar1 |
sigma non-opioid intracellular receptor 1 |
7955 |
ZDB-GENE-040426-1006 |
Inparanoid, OMA, EggNOG |
| S.cerevisiae |
855242 |
ERG2 |
C-8 sterol isomerase ERG2 |
4932 |
S000004815 |
Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.