JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

GFRAL

Description	GDNF family receptor alpha-like

Gene and Protein Information

Gene ID	389400
Uniprot Accession IDs	Q6UXV0 Q5VTF6
Ensembl ID	ENSG00000187871
Symbol	C6orf144 GRAL UNQ9356 C6orf144 bA360D14.1
Chromosome	6
Family	Belongs to the GDNFR family.
Sequence	MIVFIFLAMGLSLENEYTSQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGEVIYAAMCMTVTCGILLLVMVKLRTSRISSKARDPSSIQIPGEL Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	743306	GFRAL	GDNF family receptor alpha like	9598	VGNC:2838	OMA, EggNOG
Mouse	404194	Gfral	GDNF family receptor alpha like	10090	MGI:3607786	Inparanoid, OMA, EggNOG
Rat	501023	Gfral	GDNF family receptor alpha like	10116	RGD:1565220	Inparanoid, OMA, EggNOG
Dog	481851	GFRAL	GDNF family receptor alpha like	9615	VGNC:41192	Inparanoid, OMA, EggNOG
Horse	100069686	GFRAL	GDNF family receptor alpha like	9796	VGNC:18319	Inparanoid, OMA, EggNOG
Cow	531956	GFRAL	GDNF family receptor alpha like	9913	VGNC:53972	Inparanoid, OMA, EggNOG
Pig	100521501	GFRAL	GDNF family receptor alpha like	9823		Inparanoid, OMA, EggNOG
Chicken	421887	GFRAL	GDNF family receptor alpha like	9031	CGNC:12187	OMA, EggNOG
Anole lizard		GFRAL	GDNF family receptor alpha like [Source:HGNC Symbol;Acc:HGNC:32789]	28377		Inparanoid, OMA, EggNOG
Zebrafish	561326	gfral	GDNF family receptor alpha like	7955	ZDB-GENE-110607-2	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.