JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

SHBG

Description	Sex hormone-binding globulin

Gene and Protein Information

Gene ID	6462
Uniprot Accession IDs	P04278 B0FWH4 E9PGW1 F5H5Z8 I3L1N7 P14689 Q16616 Q3MIL0 Q6ISD2 SHBG
Ensembl ID	ENSG00000129214
Symbol	ABP SBP TEBG
Chromosome	17
Sequence	MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	455215	SHBG	sex hormone binding globulin	9598	VGNC:9607	OMA, EggNOG
Macaque	716004	SHBG	sex hormone binding globulin	9544		Inparanoid, OMA, EggNOG
Mouse	20415	Shbg	sex hormone binding globulin	10090	MGI:98295	Inparanoid, OMA, EggNOG
Rat	24775	Shbg	sex hormone binding globulin	10116	RGD:3671	Inparanoid, OMA, EggNOG
Dog	100856157	SHBG	sex hormone binding globulin	9615	VGNC:46139	Inparanoid, OMA, EggNOG
Horse	100073011	SHBG	sex hormone binding globulin	9796	VGNC:22954	Inparanoid, OMA, EggNOG
Cow	404182	SHBG	sex hormone binding globulin	9913	VGNC:34589	Inparanoid, OMA, EggNOG
Opossum	100015497	SHBG	sex hormone binding globulin	13616		Inparanoid, OMA, EggNOG
Zebrafish	322604	shbg	sex hormone-binding globulin	7955	ZDB-GENE-030131-1324	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.