JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

SFRP4

Description	Secreted frizzled-related protein 4

Gene and Protein Information

Gene ID	6424
Uniprot Accession IDs	Q6FHJ7 B4DYC1 O14877 Q05BG7 Q1ZYW2 Q4G124 Q6FHM0 Q6PD64 sFRP-4
Ensembl ID	ENSG00000106483
Symbol	FRPHE PYL FRP-4 FRPHE FRZB-2 sFRP-4
Chromosome	7
Family	Belongs to the secreted frizzled-related protein (sFRP) family.
Sequence	MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	463356	SFRP4	secreted frizzled related protein 4	9598	VGNC:9071	Inparanoid, OMA, EggNOG
Macaque	574393	SFRP4	secreted frizzled related protein 4	9544		Inparanoid, OMA, EggNOG
Mouse	20379	Sfrp4	secreted frizzled-related protein 4	10090	MGI:892010	Inparanoid, OMA, EggNOG
Rat	89803	Sfrp4	secreted frizzled-related protein 4	10116	RGD:621075	Inparanoid, OMA
Dog	483258	SFRP4	secreted frizzled related protein 4	9615	VGNC:46082	Inparanoid, OMA, EggNOG
Horse	100051069	SFRP4	secreted frizzled related protein 4	9796	VGNC:22899	Inparanoid, OMA, EggNOG
Cow	518004	SFRP4	secreted frizzled related protein 4	9913	VGNC:34522	Inparanoid, OMA, EggNOG
Opossum	100617913	SFRP4	secreted frizzled related protein 4	13616		Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.