JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

TMX1

Description	Thioredoxin-related transmembrane protein 1

Gene and Protein Information

Gene ID	81542
Uniprot Accession IDs	Q9H3N1 B2R7A4 Q8N487 Q8NBN5 Q9Y4T6
Ensembl ID	ENSG00000139921
Symbol	TMX TXNDC TXNDC1 TMX TXNDC PDIA11 TXNDC1
Chromosome	14
Sequence	MAPSGSLAVPLAVLVLLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLGLCMIFVADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	467454	TMX1	thioredoxin related transmembrane protein 1	9598	VGNC:7453	OMA, EggNOG
Macaque	707057	TMX1	thioredoxin related transmembrane protein 1	9544		Inparanoid, OMA, EggNOG
Mouse	72736	Tmx1	thioredoxin-related transmembrane protein 1	10090	MGI:1919986	Inparanoid, OMA, EggNOG
Rat	362751	Tmx1	thioredoxin-related transmembrane protein 1	10116	RGD:1308455	Inparanoid, OMA
Dog	610791	TMX1	thioredoxin related transmembrane protein 1	9615	VGNC:47643	Inparanoid, OMA, EggNOG
Horse	100066874	TMX1	thioredoxin related transmembrane protein 1	9796	VGNC:24353	Inparanoid, OMA, EggNOG
Cow	509037	TMX1	thioredoxin related transmembrane protein 1	9913	VGNC:50016	Inparanoid, OMA, EggNOG
Opossum	100009850	TMX1	thioredoxin related transmembrane protein 1	13616		Inparanoid, EggNOG
Platypus	100084874	TMX1	thioredoxin related transmembrane protein 1	9258		Inparanoid, OMA, EggNOG
Anole lizard	100563679	tmx1	thioredoxin related transmembrane protein 1	28377		Inparanoid, OMA, EggNOG
Xenopus	549660	tmx1	thioredoxin-related transmembrane protein 1	8364	XB-GENE-1015794	Inparanoid, OMA, EggNOG
Zebrafish	323607	tmx1	thioredoxin-related transmembrane protein 1	7955	ZDB-GENE-030131-2327	Inparanoid, OMA, EggNOG
C. elegans	179040	dpy-11	DumPY: shorter than wild-type	6239		Inparanoid, OMA
Fruitfly	37775	CG5554	CG5554 gene product from transcript CG5554-RB	7227	FBgn0034914	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.