JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

TOMM34

Description	Mitochondrial import receptor subunit TOM34

Gene and Protein Information

Gene ID	10953
Uniprot Accession IDs	Q15785 Q53GH9 Q6IBN7 Q9NTZ3 hTom34
Ensembl ID	ENSG00000025772
Symbol	URCC3 TOM34 URCC3 HTOM34P
Chromosome	20
Family	Belongs to the Tom34 family.
Sequence	MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	458274	TOMM34	translocase of outer mitochondrial membrane 34	9598	VGNC:6285	Inparanoid, OMA, EggNOG
Mouse	67145	Tomm34	translocase of outer mitochondrial membrane 34	10090	MGI:1914395	Inparanoid, OMA, EggNOG
Rat	311621	Tomm34	translocase of outer mitochondrial membrane 34	10116	RGD:1309029	Inparanoid, OMA
Dog	477239	TOMM34	translocase of outer mitochondrial membrane 34	9615	VGNC:49628	Inparanoid, OMA, EggNOG
Horse	100070847	TOMM34	translocase of outer mitochondrial membrane 34	9796	VGNC:50511	Inparanoid, OMA, EggNOG
Cow	508142	TOMM34	translocase of outer mitochondrial membrane 34	9913	VGNC:49135	Inparanoid, OMA, EggNOG
Pig	100157194	TOMM34	translocase of outer mitochondrial membrane 34	9823		Inparanoid, OMA, EggNOG
Opossum		TOMM34	translocase of outer mitochondrial membrane 34 [Source:HGNC Symbol;Acc:HGNC:15746]	13616		Inparanoid, EggNOG
Chicken	419188	TOMM34	translocase of outer mitochondrial membrane 34	9031	CGNC:3015	Inparanoid, OMA
Anole lizard	100561170	tomm34	translocase of outer mitochondrial membrane 34	28377		Inparanoid, OMA, EggNOG
Zebrafish	323361	tomm34	translocase of outer mitochondrial membrane 34	7955	ZDB-GENE-030131-2081	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.