JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

TIMM8A

Description	Mitochondrial import inner membrane translocase subunit Tim8 A

Gene and Protein Information

Gene ID	1678
Uniprot Accession IDs	O60220 B2R5A6 Q6IRW6
Ensembl ID	ENSG00000126953
Symbol	DDP DDP1 TIM8A DDP MTS DDP1 DFN1 TIM8
Chromosome	X
Family	Belongs to the small Tim family.
Sequence	MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	738690	TIMM8A	translocase of inner mitochondrial membrane 8A	9598	VGNC:14722	OMA, EggNOG
Mouse	30058	Timm8a1	translocase of inner mitochondrial membrane 8A1	10090	MGI:1353433	Inparanoid, OMA, EggNOG
Dog	480986	TIMM8A	translocase of inner mitochondrial membrane 8A	9615	VGNC:49623	Inparanoid, OMA, EggNOG
Cow	515109	TIMM8A	translocase of inner mitochondrial membrane 8A	9913	VGNC:49578	Inparanoid, OMA, EggNOG
Opossum	100618232	TIMM8A	translocase of inner mitochondrial membrane 8A	13616		OMA, EggNOG
Platypus	100082840	TIMM8A	translocase of inner mitochondrial membrane 8A	9258		Inparanoid, OMA, EggNOG
Chicken	422190	TIMM8A	translocase of inner mitochondrial membrane 8 homolog A (yeast)	9031	CGNC:3689	Inparanoid, OMA, EggNOG
Anole lizard	100559810	timm8a	translocase of inner mitochondrial membrane 8A	28377		Inparanoid, OMA, EggNOG
Zebrafish	445243	timm8a	translocase of inner mitochondrial membrane 8 homolog A (yeast)	7955	ZDB-GENE-040801-158	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.