JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

TAS2R40

Description	Taste receptor type 2 member 40

Gene and Protein Information

Gene ID	259286
Uniprot Accession IDs	P59535 A4D2I2 Q645W6 T2R40
Ensembl ID	ENSG00000221937
Symbol	GPR60 GPR60 T2R40 T2R58
Chromosome	7
Family	Belongs to the G-protein coupled receptor T2R family.
Sequence	MATVNTDATDKDISKFKVTFTLVVSGIECITGILGSGFITAIYGAEWARGKTLPTGDRIMLMLSFSRLLLQIWMMLENIFSLLFRIVYNQNSVYILFKVITVFLNHSNLWFAAWLKVFYCLRIANFNHPLFFLMKRKIIVLMPWLLRLSVLVSLSFSFPLSRDVFNVYVNSSIPIPSSNSTEKKYFSETNMVNLVFFYNMGIFVPLIMFILAATLLILSLKRHTLHMGSNATGSRDPSMKAHIGAIKATSYFLILYIFNAIALFLSTSNIFDTYSSWNILCKIIMAAYPAGHSVQLILGNPGLRRAWKRFQHQVPLYLKGQTL Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	472611	TAS2R40	taste 2 receptor member 40	9598	VGNC:8774	Inparanoid, OMA, EggNOG
Macaque	706077	TAS2R40	taste 2 receptor member 40	9544		Inparanoid, OMA, EggNOG
Mouse	387515	Tas2r144	taste receptor, type 2, member 144	10090	MGI:2681312	Inparanoid, OMA, EggNOG
Rat	500101	Tas2r144	taste receptor, type 2, member 144	10116	RGD:1562314	Inparanoid, OMA, EggNOG
Dog	608842	TAS2R40	taste 2 receptor member 40	9615	VGNC:47119	Inparanoid, OMA, EggNOG
Horse	100050534	TAS2R40	taste 2 receptor member 40	9796	VGNC:23883	Inparanoid, OMA, EggNOG
Cow	785133	TAS2R40	taste 2 receptor member 40	9913	VGNC:35614	OMA, EggNOG
Pig	106508195	TAS2R40	taste 2 receptor member 40	9823		OMA, EggNOG
Opossum	664679	T2R40	bitter taste receptor Modo-T2R40	13616		Inparanoid, OMA, EggNOG

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 40

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.