JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

TAS2R38

Description	Taste receptor type 2 member 38

Gene and Protein Information

Gene ID	5726
Uniprot Accession IDs	P59533 A4D1U6 P59552 Q2M3E8 Q645W3 Q86UK3 T2R38
Ensembl ID	ENSG00000257138
Symbol	PTC PTC T2R38 T2R61 THIOT
Chromosome	7
Family	Belongs to the G-protein coupled receptor T2R family.
Sequence	MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCLSISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNSRDPSLEAHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVMVCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLKVRADHKADSRTLC Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	493889	TAS2R38	taste 2 receptor member 38	9598	VGNC:8771	Inparanoid, OMA
Macaque	695549	TAS2R38	taste 2 receptor member 38	9544		Inparanoid, OMA
Mouse	387513	Tas2r138	taste receptor, type 2, member 138	10090	MGI:2681306	Inparanoid, OMA
Dog	100271737	TAS2R38	taste 2 receptor member 38	9615	VGNC:47117	Inparanoid, OMA
Horse	106783090	TAS2R38	taste 2 receptor member 38	9796	VGNC:23881	Inparanoid, OMA
Cow	787789	TAS2R38	taste 2 receptor member 38	9913	VGNC:35612	Inparanoid, OMA

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 38

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.