JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

TNFSF14

Description	Tumor necrosis factor ligand superfamily member 14

Gene and Protein Information

Gene ID	8740
Uniprot Accession IDs	O43557 A8K7M2 C9J5H4 O75476 Q6FHA1 Q8WVF8 Q96LD2
Ensembl ID	ENSG00000125735
Symbol	HVEML LIGHT LTg CD258 HVEML LIGHT
Chromosome	19
Family	Belongs to the tumor necrosis factor family.
Sequence	MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	468687	TNFSF14	TNF superfamily member 14	9598	VGNC:3583	OMA, EggNOG
Macaque	701451	TNFSF14	TNF superfamily member 14	9544		Inparanoid, OMA, EggNOG
Mouse	50930	Tnfsf14	tumor necrosis factor (ligand) superfamily, member 14	10090	MGI:1355317	Inparanoid, OMA, EggNOG
Rat	301133	Tnfsf14	TNF superfamily member 14	10116	RGD:1588572	Inparanoid, OMA, EggNOG
Dog	611306	TNFSF14	TNF superfamily member 14	9615	VGNC:47670	Inparanoid, OMA, EggNOG
Horse	100060470	TNFSF14	TNF superfamily member 14	9796	VGNC:24376	Inparanoid, OMA, EggNOG
Cow	505521	TNFSF14	TNF superfamily member 14	9913	VGNC:36173	Inparanoid, OMA, EggNOG
Pig	100519468	TNFSF14	TNF superfamily member 14	9823		OMA, EggNOG
Opossum	100026161	TNFSF14	TNF superfamily member 14	13616		Inparanoid, OMA, EggNOG
Platypus	100074301	TNFSF14	TNF superfamily member 14	9258		Inparanoid, OMA, EggNOG
Anole lizard	103277724	tnfsf14	TNF superfamily member 14	28377		Inparanoid, OMA, EggNOG

PANTHER Classes
protein / signaling molecule / tumor necrosis factor family member / Tumor necrosis factor ligand superfamily member 14

DTO Classes
protein / Signaling / Cytokine / Tumor necrosis factor family member / Tumor necrosis factor ligand superfamily member 14

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.