JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

TNFSF8

Description	Tumor necrosis factor ligand superfamily member 8

Gene and Protein Information

Gene ID	944
Uniprot Accession IDs	P32971 O43404
Ensembl ID	ENSG00000106952
Symbol	CD30L CD30LG CD153 CD30L CD30LG TNLG3A
Chromosome	9
Family	Belongs to the tumor necrosis factor family.
Sequence	MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	464686	TNFSF8	TNF superfamily member 8	9598	VGNC:4886	OMA, EggNOG
Macaque	702944	TNFSF8	TNF superfamily member 8	9544		Inparanoid, EggNOG
Mouse	21949	Tnfsf8	tumor necrosis factor (ligand) superfamily, member 8	10090	MGI:88328	Inparanoid, OMA, EggNOG
Rat	683163	Tnfsf8	TNF superfamily member 8	10116	RGD:1590403	Inparanoid, OMA, EggNOG
Dog	612608	TNFSF8	TNF superfamily member 8	9615	VGNC:47673	Inparanoid, OMA, EggNOG
Horse	100051061	TNFSF8	TNF superfamily member 8	9796	VGNC:24380	Inparanoid, OMA, EggNOG
Cow	574056	TNFSF8	TNF superfamily member 8	9913	VGNC:36177	Inparanoid, OMA, EggNOG
Opossum	100013881	TNFSF8	TNF superfamily member 8	13616		Inparanoid, EggNOG
Platypus	100076721	TNFSF8	TNF superfamily member 8	9258		Inparanoid, OMA, EggNOG
Chicken	378930	TNFSF8	tumor necrosis factor superfamily member 8	9031	CGNC:5378	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.