This is a demo store. No orders will be fulfilled.

TNFRSF14

Description Tumor necrosis factor receptor superfamily member 14

Gene and Protein Information

Gene ID 8764
Uniprot Accession IDs Q92956 B3KW30 B9DI89 Q6IB95 Q8N634 Q8WXR1 Q96J31 Q9UM65
Ensembl ID ENSG00000157873
Symbol HVEA HVEM TR2 ATAR HVEA HVEM CD270 LIGHTR
Chromosome 1
Sequence
MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 457221 TNFRSF14 TNF receptor superfamily member 14 9598 VGNC:11936 OMA, EggNOG
Macaque 695042 TNFRSF14 TNF receptor superfamily member 14 9544 Inparanoid, OMA, EggNOG
Mouse 230979 Tnfrsf14 tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) 10090 MGI:2675303 Inparanoid, OMA
Rat 366518 Tnfrsf14 TNF receptor superfamily member 14 10116 RGD:1310115 Inparanoid, OMA, EggNOG
Dog 479580 TNFRSF14 TNF receptor superfamily member 14 9615 VGNC:47658 Inparanoid, OMA, EggNOG
Zebrafish 100535903 si:ch211-261n11.7 si:ch211-261n11.7 7955 ZDB-GENE-081105-144 OMA, EggNOG

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.