The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
PRKACG
| Description |
cAMP-dependent protein kinase catalytic subunit gamma
|
Gene and Protein Information
| Gene ID |
5568
|
| Uniprot Accession IDs |
P22612
O60850
Q5VZ02
Q86YI1
PKA C-gamma
|
| Ensembl ID |
ENSG00000165059
|
| Symbol |
KAPG
PKACg
BDPLT19
|
| Chromosome |
9
|
| Family |
Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily. |
| Sequence |
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
Show more
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
472944 |
PRKACG |
protein kinase cAMP-activated catalytic subunit gamma |
9598 |
VGNC:13947 |
OMA, EggNOG |
| Macaque |
700652 |
PRKACG |
protein kinase cAMP-activated catalytic subunit gamma |
9544 |
|
OMA, EggNOG |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.