JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

IL12A

Description	Interleukin-12 subunit alpha

Gene and Protein Information

Gene ID	3592
Uniprot Accession IDs	P29459 Q96QZ1 IL-12A
Ensembl ID	ENSG00000168811
Symbol	NKSF1 P35 CLMF NFSK NKSF1 IL-12A
Chromosome	3
Family	Belongs to the IL-6 superfamily.
Sequence	MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	460816	IL12A	interleukin 12A	9598	VGNC:1843	OMA, EggNOG
Macaque	703205	IL12A	interleukin 12A	9544		Inparanoid, OMA, EggNOG
Mouse	16159	Il12a	interleukin 12a	10090	MGI:96539	Inparanoid, OMA, EggNOG
Rat	84405	Il12a	interleukin 12A	10116	RGD:620562	Inparanoid, OMA, EggNOG
Dog	403977	IL12A	interleukin 12A	9615	VGNC:41932	Inparanoid, OMA, EggNOG
Horse	100034215	IL12A	interleukin 12A	9796	VGNC:50844	Inparanoid, OMA, EggNOG
Cow	281856	IL12A	interleukin 12A	9913	VGNC:30110	Inparanoid, OMA, EggNOG
Pig	397053	IL12A	interleukin 12A	9823		Inparanoid, OMA, EggNOG
Opossum	100018516	IL12A	interleukin 12A	13616		Inparanoid, OMA, EggNOG
Chicken	407090	IL12A	interleukin 12A	9031	CGNC:7289	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.