JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Account

Settings

Language

྾

Home
Targets(Human)
IL10RB

IL10RB

Description	Interleukin-10 receptor subunit beta

Gene and Protein Information

Gene ID	3588
Uniprot Accession IDs	Q08334 Q9BUU4 IL-10 receptor subunit beta
Ensembl ID	ENSG00000243646
Symbol	CRFB4 D21S58 D21S66 CRFB4 CRF2-4 D21S58 D21S66 CDW210B IL-10R2
Chromosome	21
Family	Belongs to the type II cytokine receptor family.
Sequence	MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	473966	LOC473966	interleukin-10 receptor subunit beta	9598		OMA, EggNOG
Mouse	16155	Il10rb	interleukin 10 receptor, beta	10090	MGI:109380	Inparanoid, OMA, EggNOG
Rat	304091	Il10rb	interleukin 10 receptor subunit beta	10116	RGD:1560373	Inparanoid, OMA, EggNOG
Dog	100856489	IL10RB	interleukin 10 receptor subunit beta	9615		Inparanoid, EggNOG
Horse	100052549	IL10RB	interleukin 10 receptor subunit beta	9796		OMA, EggNOG
Cow	767864	IL10RB	interleukin 10 receptor subunit beta	9913		Inparanoid, OMA, EggNOG
Opossum	100026691	IL10RB	interleukin 10 receptor subunit beta	13616		OMA, EggNOG
Anole lizard	103281134	LOC103281134	interleukin-10 receptor subunit beta	28377		OMA, EggNOG
Zebrafish	797527	crfb4	cytokine receptor family member b4	7955	ZDB-GENE-070905-3	OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    type II cytokine receptor    /    Interleukin-10 receptor subunit beta
protein    /    receptor    /    defense/immunity protein    /    Interleukin-10 receptor subunit beta
protein    /    receptor    /    type I cytokine receptor    /    Interleukin-10 receptor subunit beta

DTO Classes
protein / Receptor / Cytokine receptor / Type II cytokine receptor / Interleukin-10 receptor subunit beta

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Related active small molecules

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.