This is a demo store. No orders will be fulfilled.

RBCK1

Description RanBP-type and C3HC4-type zinc finger-containing protein 1

Gene and Protein Information

Gene ID 10616
Uniprot Accession IDs Q9BYM8 O95623 Q86SL2 Q96BS3 Q9BYM9
Ensembl ID ENSG00000125826
Symbol C20orf18 RNF54 UBCE7IP3 XAP3 XAP4 XAP3 XAP4 HOIL1 PBMEI PGBM1 RBCK2 RNF54 HOIL-1 ZRANB4 C20orf18 UBCE7IP3
Chromosome 20
Family Belongs to the RBR family.
Sequence
MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 458025 RBCK1 RANBP2-type and C3HC4-type zinc finger containing 1 9598 VGNC:9966 OMA, EggNOG
Macaque 714692 RBCK1 RANBP2-type and C3HC4-type zinc finger containing 1 9544 Inparanoid, OMA, EggNOG
Mouse 24105 Rbck1 RanBP-type and C3HC4-type zinc finger containing 1 10090 MGI:1344372 Inparanoid, OMA, EggNOG
Rat 60383 Rbck1 RANBP2-type and C3HC4-type zinc finger containing 1 10116 RGD:708404 Inparanoid, OMA
Dog 485818 RBCK1 RANBP2-type and C3HC4-type zinc finger containing 1 9615 VGNC:45397 Inparanoid, OMA, EggNOG
Horse 100067987 RBCK1 RANBP2-type and C3HC4-type zinc finger containing 1 9796 VGNC:51596 Inparanoid, OMA, EggNOG
Cow 504400 RBCK1 RANBP2-type and C3HC4-type zinc finger containing 1 9913 VGNC:33776 OMA, EggNOG
Opossum 100011102 RBCK1 RANBP2-type and C3HC4-type zinc finger containing 1 13616 Inparanoid, EggNOG
Anole lizard 100562899 rbck1 RANBP2-type and C3HC4-type zinc finger containing 1 28377 Inparanoid, OMA
Zebrafish 569903 shrprbck1r sharpin and rbck1 related 7955 ZDB-GENE-080220-52 Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    ligase    /    ubiquitin-protein ligase    /    RanBP-type and C3HC4-type zinc finger-containing protein 1
DTO Classes
protein    /    Enzyme    /    Ligase    /    Ubiquitin-protein ligase    /    RanBP-type and C3HC4-type zinc finger-containing protein 1

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.