JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

FFAR3

Description	Free fatty acid receptor 3

Gene and Protein Information

Gene ID	2865
Uniprot Accession IDs	O14843 B2RWM8 Q14CM7
Ensembl ID	ENSG00000185897
Symbol	GPR41 FFA3R GPR41 GPR42
Chromosome	19
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	455946	LOC455946	free fatty acid receptor 3	9598		OMA, EggNOG
Mouse	233080	Ffar3	free fatty acid receptor 3	10090	MGI:2685324	OMA, EggNOG
Rat	365228	Ffar3	free fatty acid receptor 3	10116	RGD:1311035	OMA, EggNOG
Horse	102150446	FFAR3	free fatty acid receptor 3	9796		OMA, EggNOG
Cow	527517	FFAR3	free fatty acid receptor 3	9913		OMA, EggNOG
Pig	100517655	FFAR3	free fatty acid receptor 3	9823		OMA, EggNOG
Opossum	100015775	FFAR3	free fatty acid receptor 3	13616		OMA, EggNOG

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Free fatty acid receptor / Free fatty acid receptor 3

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.