JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

FGF12

Description	Fibroblast growth factor 12

Gene and Protein Information

Gene ID	2257
Uniprot Accession IDs	P61328 B2R6B7 B2R976 O35339 P70376 Q8TBG5 Q92912 Q93001 FGF-12
Ensembl ID	ENSG00000114279
Symbol	FGF12B FHF1 FHF1 EIEE47 FGF12B
Chromosome	3
Family	Belongs to the heparin-binding growth factors family.
Sequence	MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	705813	FGF12	fibroblast growth factor 12	9544		Inparanoid, OMA, EggNOG
Mouse	14167	Fgf12	fibroblast growth factor 12	10090	MGI:109183	Inparanoid, OMA, EggNOG
Rat	170630	Fgf12	fibroblast growth factor 12	10116	RGD:620163	Inparanoid, OMA
Dog	478676	FGF12	fibroblast growth factor 12	9615	VGNC:40841	Inparanoid, OMA, EggNOG
Horse	100059907	FGF12	fibroblast growth factor 12	9796	VGNC:18011	Inparanoid, OMA, EggNOG
Cow	615823	FGF12	fibroblast growth factor 12	9913	VGNC:53568	Inparanoid, OMA, EggNOG
Opossum	100010502	FGF12	fibroblast growth factor 12	13616		Inparanoid, OMA, EggNOG
Anole lizard	100554590	LOC100554590	fibroblast growth factor 12	28377		OMA, EggNOG
Xenopus	100101804	fgf12	fibroblast growth factor 12	8364	XB-GENE-479999	Inparanoid, OMA
Zebrafish	777735	fgf12a	fibroblast growth factor 12a	7955	ZDB-GENE-050221-6	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / signaling molecule / growth factor / Fibroblast growth factor 12

DTO Classes
protein / Signaling / Growth factor / Fibroblast growth factor 12

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.