JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Account

Settings

Language

྾

Home
Targets(Human)
CDX1

CDX1

Description	Homeobox protein CDX-1

Gene and Protein Information

Gene ID	1044
Uniprot Accession IDs	P47902 Q4VAU4 Q9NYK8
Ensembl ID	ENSG00000113722
Chromosome	5
Family	Belongs to the Caudal homeobox family.
Sequence	MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPGTPSSPGAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	471693	CDX1	caudal type homeobox 1	9598	VGNC:11880	OMA, EggNOG
Mouse	12590	Cdx1	caudal type homeobox 1	10090	MGI:88360	Inparanoid, OMA, EggNOG
Dog	612256	CDX1	caudal type homeobox 1	9615	VGNC:39084	Inparanoid, OMA, EggNOG
Pig	100626275	CDX1	caudal type homeobox 1	9823		OMA, EggNOG
Opossum	100024158	CDX1	caudal type homeobox 1	13616		Inparanoid, EggNOG
Chicken	395397	CDX1	caudal type homeobox 1	9031	CGNC:4232	OMA, EggNOG
Anole lizard	100564110	cdx1	caudal type homeobox 1	28377		Inparanoid, EggNOG
Xenopus	395055	cdx1	caudal type homeobox 1	8364	XB-GENE-485396	Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Homeobox protein CDX-1
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein CDX-1

DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein CDX-1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Related active small molecules

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.