JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

FGF7

Description	Fibroblast growth factor 7

Gene and Protein Information

Gene ID	2252
Uniprot Accession IDs	P21781 H0YNY5 Q6FGV5 Q96FG5 FGF-7
Ensembl ID	ENSG00000140285
Symbol	KGF KGF HBGF-7
Chromosome	15
Family	Belongs to the heparin-binding growth factors family.
Sequence	MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	744975	FGF7	fibroblast growth factor 7	9598	VGNC:11889	OMA, EggNOG
Macaque	574345	FGF7	fibroblast growth factor 7	9544		Inparanoid, OMA, EggNOG
Mouse	14178	Fgf7	fibroblast growth factor 7	10090	MGI:95521	Inparanoid, OMA, EggNOG
Rat	29348	Fgf7	fibroblast growth factor 7	10116	RGD:61805	Inparanoid, OMA, EggNOG
Dog	403915	FGF7	fibroblast growth factor 7	9615	VGNC:40853	Inparanoid, OMA, EggNOG
Horse	100033961	FGF7	fibroblast growth factor 7	9796	VGNC:18020	Inparanoid, OMA, EggNOG
Cow	616885	FGF7	fibroblast growth factor 7	9913	VGNC:28982	Inparanoid, OMA, EggNOG
Opossum	100025923	FGF7	fibroblast growth factor 7	13616		Inparanoid, EggNOG
Chicken	415439	FGF7	fibroblast growth factor 7	9031	CGNC:66242	Inparanoid, OMA
Anole lizard	100558897	fgf7	fibroblast growth factor 7	28377		Inparanoid, OMA, EggNOG
Xenopus	496833	fgf7	fibroblast growth factor 7	8364	XB-GENE-488183	Inparanoid, OMA, EggNOG
Zebrafish	493181	fgf7	fibroblast growth factor 7	7955	ZDB-GENE-080122-1	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / signaling molecule / growth factor / Fibroblast growth factor 7

DTO Classes
protein / Signaling / Growth factor / Fibroblast growth factor 7

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.