JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

FGF19

Description	Fibroblast growth factor 19

Gene and Protein Information

Gene ID	9965
Uniprot Accession IDs	O95750 FGF-19
Ensembl ID	ENSG00000162344
Chromosome	11
Family	Belongs to the heparin-binding growth factors family.
Sequence	MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	747710	FGF19	fibroblast growth factor 19	9598	VGNC:1054	OMA, EggNOG
Mouse	14170	Fgf15	fibroblast growth factor 15	10090	MGI:1096383	Inparanoid, OMA, EggNOG
Rat	170582	Fgf19	fibroblast growth factor 19	10116	RGD:620166	Inparanoid, OMA, EggNOG
Dog	483681	FGF19	fibroblast growth factor 19	9615	VGNC:40846	Inparanoid, OMA, EggNOG
Cow	521475	FGF19	fibroblast growth factor 19	9913	VGNC:28975	Inparanoid, OMA, EggNOG
Pig	100518950	FGF19	fibroblast growth factor 19	9823		OMA, EggNOG
Opossum	100021575	FGF19	fibroblast growth factor 19	13616		Inparanoid, OMA, EggNOG
Chicken	395394	FGF19	fibroblast growth factor 19	9031	CGNC:66203	Inparanoid, OMA
Anole lizard	100565023	fgf19	fibroblast growth factor 19	28377		Inparanoid, OMA, EggNOG
Xenopus	100217329	fgf19	fibroblast growth factor 19	8364	XB-GENE-486499	Inparanoid, OMA, EggNOG
Zebrafish	368245	fgf19	fibroblast growth factor 19	7955	ZDB-GENE-030729-32	Inparanoid, OMA

PANTHER Classes
protein / signaling molecule / growth factor / Fibroblast growth factor 19

DTO Classes
protein / Signaling / Growth factor / Fibroblast growth factor 19

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.