JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

GAST

Description	Gastrin

Gene and Protein Information

Gene ID	2520
Uniprot Accession IDs	P01350 P78463 P78464
Ensembl ID	ENSG00000184502
Symbol	GAS GAS
Chromosome	17
Family	Belongs to the gastrin/cholecystokinin family.
Sequence	MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	468262	GAST	gastrin	9598	VGNC:12143	OMA, EggNOG
Mouse	14459	Gast	gastrin	10090	MGI:104768	Inparanoid, OMA, EggNOG
Rat	25320	Gast	gastrin	10116	RGD:2662	Inparanoid, OMA, EggNOG
Dog	100685087	GAST	gastrin	9615	VGNC:41121	Inparanoid, OMA, EggNOG
Horse	100034214	GAST	gastrin	9796	VGNC:49456	Inparanoid, OMA, EggNOG
Cow	280800	GAST	gastrin	9913	VGNC:29264	Inparanoid, OMA, EggNOG
Pig	445524	GAST	gastrin	9823		Inparanoid, OMA, EggNOG
Opossum	100013059	GAST	gastrin	13616		Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.