JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

HAMP

Description	Hepcidin

Gene and Protein Information

Gene ID	57817
Uniprot Accession IDs	P81172 Q1HE14 Q9BY68
Ensembl ID	ENSG00000105697
Symbol	HEPC LEAP1 HEPC PLTR HFE2B LEAP1
Chromosome	19
Family	Belongs to the hepcidin family.
Sequence	MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	744861	HAMP	hepcidin antimicrobial peptide	9598	VGNC:2552	Inparanoid, OMA, EggNOG
Macaque	708397	HAMP	hepcidin antimicrobial peptide	9544		Inparanoid, OMA, EggNOG
Mouse	66438	Hamp2	hepcidin antimicrobial peptide 2	10090	MGI:2153530	Inparanoid, OMA, EggNOG
Rat	84604	Hamp	hepcidin antimicrobial peptide	10116	RGD:70971	Inparanoid, OMA
Dog	492281	HAMP	hepcidin antimicrobial peptide	9615	VGNC:41588	Inparanoid, OMA, EggNOG
Cow	512301	HAMP	hepcidin antimicrobial peptide	9913	VGNC:29745	Inparanoid, OMA, EggNOG
Opossum	103099012	HAMP	hepcidin antimicrobial peptide	13616		Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.