JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

HMOX1

Description	Heme oxygenase 1

Gene and Protein Information

Gene ID	3162
Uniprot Accession IDs	P09601 HO-1
Ensembl ID	ENSG00000100292
Symbol	HO HO1 HO-1 HSP32 HMOX1D bK286B10
Chromosome	22
Family	Belongs to the heme oxygenase family.
Sequence	MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	470195	HMOX1	heme oxygenase 1	9598	VGNC:5270	OMA, EggNOG
Macaque	719266	HMOX1	heme oxygenase 1	9544		Inparanoid, OMA
Mouse	15368	Hmox1	heme oxygenase 1	10090	MGI:96163	Inparanoid, OMA, EggNOG
Rat	24451	Hmox1	heme oxygenase 1	10116	RGD:2806	Inparanoid, OMA, EggNOG
Dog	442987	HMOX1	heme oxygenase 1	9615	VGNC:41719	Inparanoid, OMA, EggNOG
Horse	100069058	HMOX1	heme oxygenase 1	9796	VGNC:18814	Inparanoid, OMA, EggNOG
Cow	513221	HMOX1	heme oxygenase 1	9913	VGNC:29885	Inparanoid, OMA, EggNOG
Opossum	100030714	LOC100030714	heme oxygenase 1-like	13616		OMA, EggNOG
Platypus		HMOX1	heme oxygenase 1 [Source:HGNC Symbol;Acc:HGNC:5013]	9258		OMA, EggNOG
Chicken	396287	HMOX1	heme oxygenase 1	9031	CGNC:49737	Inparanoid, OMA, EggNOG
Anole lizard	100555210	hmox1	heme oxygenase 1	28377		Inparanoid, OMA, EggNOG
Xenopus	100488303	hmox1	heme oxygenase 1	8364	XB-GENE-1002243	Inparanoid, OMA, EggNOG
Zebrafish	791518	hmox1a	heme oxygenase 1a	7955	ZDB-GENE-030131-3102	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.