JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

FABP3

Description	Fatty acid-binding protein, heart

Gene and Protein Information

Gene ID	2170
Uniprot Accession IDs	P05413 B2RAB6 Q5VV93 Q99957
Ensembl ID	ENSG00000121769
Symbol	FABP11 MDGI MDGI FABP11 H-FABP M-FABP O-FABP
Chromosome	1
Family	Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Sequence	MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	456699	FABP3	fatty acid binding protein 3	9598	VGNC:6801	OMA, EggNOG
Mouse	14074	Fabp3-ps1	fatty acid binding protein 3, muscle and heart, pseudogene 1	10090	MGI:101929	Inparanoid, OMA
Rat	79131	Fabp3	fatty acid binding protein 3	10116	RGD:69048	Inparanoid, OMA, EggNOG
Dog	478156	FABP3	fatty acid binding protein 3	9615	VGNC:40561	Inparanoid, OMA, EggNOG
Horse	100033895	FABP3	fatty acid binding protein 3	9796	VGNC:17768	Inparanoid, OMA, EggNOG
Cow	281758	FABP3	fatty acid binding protein 3	9913	VGNC:28697	Inparanoid, OMA, EggNOG
Opossum		FABP3	fatty acid binding protein 3 [Source:HGNC Symbol;Acc:HGNC:3557]	13616		Inparanoid, OMA, EggNOG
Xenopus	548540	fabp3	fatty acid binding protein 3	8364	XB-GENE-974423	OMA, EggNOG
Zebrafish	171478	fabp3	fatty acid binding protein 3, muscle and heart	7955	ZDB-GENE-020318-2	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.