JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

FGF23

Description	Fibroblast growth factor 23

Gene and Protein Information

Gene ID	8074
Uniprot Accession IDs	Q9GZV9 Q4V758 FGF-23
Ensembl ID	ENSG00000118972
Symbol	HYPF ADHR FGFN HYPF HFTC2 HPDR2 PHPTC
Chromosome	12
Family	Belongs to the heparin-binding growth factors family.
Sequence	MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	747164	FGF23	fibroblast growth factor 23	9598	VGNC:5380	OMA, EggNOG
Mouse	64654	Fgf23	fibroblast growth factor 23	10090	MGI:1891427	Inparanoid, OMA, EggNOG
Rat	170583	Fgf23	fibroblast growth factor 23	10116	RGD:620178	Inparanoid, OMA
Dog	611773	FGF23	fibroblast growth factor 23	9615	VGNC:54303	OMA, EggNOG
Horse	100058460	FGF23	fibroblast growth factor 23	9796	VGNC:18017	Inparanoid, OMA, EggNOG
Cow	530239	FGF23	fibroblast growth factor 23	9913	VGNC:28978	Inparanoid, OMA, EggNOG
Opossum		FGF23	fibroblast growth factor 23 [Source:HGNC Symbol;Acc:HGNC:3680]	13616		Inparanoid, OMA, EggNOG
Chicken	428104	FGF23	fibroblast growth factor 23	9031	CGNC:66548	Inparanoid, OMA
Anole lizard	100559987	fgf23	fibroblast growth factor 23	28377		Inparanoid, OMA, EggNOG
Xenopus	100496800	fgf23.2	fibroblast growth factor 23, gene 2	8364	XB-GENE-482986	Inparanoid, OMA, EggNOG
Zebrafish	494456	fgf23	fibroblast growth factor 23	7955	ZDB-GENE-050201-4	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / signaling molecule / growth factor / Fibroblast growth factor 23

DTO Classes
protein / Signaling / Growth factor / Fibroblast growth factor 23

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.