JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

FSHB

Description	Follitropin subunit beta

Gene and Protein Information

Gene ID	2488
Uniprot Accession IDs	P01225 A2TF08 A5JVV3 Q14D61
Ensembl ID	ENSG00000131808
Symbol	HH24
Chromosome	11
Family	Belongs to the glycoprotein hormones subunit beta family.
Sequence	MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	736618	FSHB	follicle stimulating hormone subunit beta	9598	VGNC:6558	Inparanoid, OMA, EggNOG
Mouse	14308	Fshb	follicle stimulating hormone beta	10090	MGI:95582	Inparanoid, OMA, EggNOG
Rat	25447	Fshb	follicle stimulating hormone subunit beta	10116	RGD:2630	Inparanoid, OMA, EggNOG
Dog	485428	FSHB	follicle stimulating hormone subunit beta	9615	VGNC:40996	Inparanoid, OMA, EggNOG
Horse	100033829	FSHB	follicle stimulating hormone beta subunit	9796		Inparanoid, OMA, EggNOG
Cow	281171	FSHB	follicle stimulating hormone beta subunit	9913		Inparanoid, OMA, EggNOG
Pig	396895	FSHB	follicle stimulating hormone beta subunit	9823		Inparanoid, OMA, EggNOG
Opossum	554190	FSHB	follicle stimulating hormone beta subunit	13616		Inparanoid, OMA, EggNOG
Platypus	100073363	FSHB	follicle stimulating hormone beta subunit	9258		Inparanoid, OMA, EggNOG
Chicken	374108	FSHB	follicle stimulating hormone beta subunit	9031	CGNC:9209	OMA, EggNOG
Anole lizard	100568157	fshb	follicle stimulating hormone beta subunit	28377		Inparanoid, OMA, EggNOG
Xenopus	100495812	fshb	follicle stimulating hormone subunit beta	8364	XB-GENE-484695	Inparanoid, OMA, EggNOG
Zebrafish	402919	fshb	follicle stimulating hormone subunit beta	7955	ZDB-GENE-040806-1	OMA, EggNOG

PANTHER Classes
protein / signaling molecule / peptide hormone / Follitropin subunit beta

DTO Classes
protein / Signaling / Hormone / Follitropin subunit beta

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.