This is a demo store. No orders will be fulfilled.

IGHA1

Description Immunoglobulin heavy constant alpha 1

Gene and Protein Information

Gene ID 3493
Uniprot Accession IDs P01876
Symbol IgA1
Chromosome 14
Sequence
ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY
Show more

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.