JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

IGF1

Description	Insulin-like growth factor I

Gene and Protein Information

Gene ID	3479
Uniprot Accession IDs	P05019 B2RWM7 E9PD02 P01343 Q14620 IGF-I
Ensembl ID	ENSG00000017427
Symbol	IBP1 IGF MGF IGFI IGF-I
Chromosome	12
Family	Belongs to the insulin family.
Sequence	MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	741055	IGF1	insulin like growth factor 1	9598	VGNC:5427	OMA, EggNOG
Macaque	698444	IGF1	insulin like growth factor 1	9544		Inparanoid, OMA, EggNOG
Mouse	16000	Igf1	insulin-like growth factor 1	10090	MGI:96432	Inparanoid, OMA, EggNOG
Rat	24482	Igf1	insulin-like growth factor 1	10116	RGD:2868	Inparanoid, OMA, EggNOG
Dog	610255	IGF1	insulin like growth factor 1	9615	VGNC:41895	Inparanoid, OMA, EggNOG
Horse	100034198	IGF1	insulin like growth factor 1	9796	VGNC:18967	Inparanoid, OMA, EggNOG
Cow	281239	IGF1	insulin like growth factor 1	9913	VGNC:30076	Inparanoid, OMA, EggNOG
Pig	397491	IGF1	insulin like growth factor 1	9823		Inparanoid, OMA, EggNOG
Opossum	100021295	IGF1	insulin like growth factor 1	13616		Inparanoid, OMA, EggNOG
Platypus	100075905	IGF1	insulin like growth factor 1	9258		Inparanoid, OMA, EggNOG
Chicken	418090	IGF1	insulin like growth factor 1	9031	CGNC:9671	Inparanoid, OMA, EggNOG
Anole lizard	100566682	igf1	insulin like growth factor 1	28377		Inparanoid, OMA, EggNOG
Xenopus	100486334	igf1	insulin like growth factor 1	8364	XB-GENE-480239	Inparanoid, OMA, EggNOG
Zebrafish	114433	igf1	insulin-like growth factor 1	7955	ZDB-GENE-010607-2	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.