JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

IL17A

Description	Interleukin-17A

Gene and Protein Information

Gene ID	3605
Uniprot Accession IDs	Q16552 Q5T2P0 IL-17
Ensembl ID	ENSG00000112115
Symbol	CTLA8 IL17 IL17 CTLA8 IL-17 CTLA-8 IL-17A
Chromosome	6
Family	Belongs to the IL-17 family.
Sequence	MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	472029	IL17A	interleukin 17A	9598	VGNC:3123	OMA, EggNOG
Macaque	708123	IL17A	interleukin 17A	9544		Inparanoid, OMA, EggNOG
Mouse	16171	Il17a	interleukin 17A	10090	MGI:107364	Inparanoid, OMA, EggNOG
Rat	301289	Il17a	interleukin 17A	10116	RGD:2888	Inparanoid, OMA, EggNOG
Dog	481837	IL17A	interleukin 17A	9615	VGNC:41942	OMA, EggNOG
Horse	100034142	IL17A	interleukin 17A	9796	VGNC:19000	OMA, EggNOG
Cow	282863	IL17A	interleukin 17A	9913	VGNC:30117	Inparanoid, OMA, EggNOG
Pig	449530	IL17A	interleukin 17A	9823		Inparanoid, OMA, EggNOG
Opossum	100016267	IL17A	interleukin 17A	13616		Inparanoid, OMA, EggNOG
Platypus	100078889	IL17A	interleukin 17A	9258		Inparanoid, OMA, EggNOG
Chicken	428665	IL17F	interleukin 17F	9031	CGNC:53428	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.