This is a demo store. No orders will be fulfilled.

IL17A

Description Interleukin-17A

Gene and Protein Information

Gene ID 3605
Uniprot Accession IDs Q16552 Q5T2P0 IL-17
Ensembl ID ENSG00000112115
Symbol CTLA8 IL17 IL17 CTLA8 IL-17 CTLA-8 IL-17A
Chromosome 6
Family Belongs to the IL-17 family.
Sequence
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 472029 IL17A interleukin 17A 9598 VGNC:3123 OMA, EggNOG
Macaque 708123 IL17A interleukin 17A 9544 Inparanoid, OMA, EggNOG
Mouse 16171 Il17a interleukin 17A 10090 MGI:107364 Inparanoid, OMA, EggNOG
Rat 301289 Il17a interleukin 17A 10116 RGD:2888 Inparanoid, OMA, EggNOG
Dog 481837 IL17A interleukin 17A 9615 VGNC:41942 OMA, EggNOG
Horse 100034142 IL17A interleukin 17A 9796 VGNC:19000 OMA, EggNOG
Cow 282863 IL17A interleukin 17A 9913 VGNC:30117 Inparanoid, OMA, EggNOG
Pig 449530 IL17A interleukin 17A 9823 Inparanoid, OMA, EggNOG
Opossum 100016267 IL17A interleukin 17A 13616 Inparanoid, OMA, EggNOG
Platypus 100078889 IL17A interleukin 17A 9258 Inparanoid, OMA, EggNOG
Chicken 428665 IL17F interleukin 17F 9031 CGNC:53428 Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.