JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

IL11

Description	Interleukin-11

Gene and Protein Information

Gene ID	3589
Uniprot Accession IDs	P20809 B4DQV5 Q96EB4 IL-11
Ensembl ID	ENSG00000095752
Symbol	AGIF IL-11
Chromosome	19
Family	Belongs to the IL-6 superfamily.
Sequence	MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	736204	IL11	interleukin 11	9598	VGNC:2344	OMA, EggNOG
Mouse	16156	Il11	interleukin 11	10090	MGI:107613	Inparanoid, OMA, EggNOG
Rat	171040	Il11	interleukin 11	10116	RGD:621475	Inparanoid, OMA, EggNOG
Dog	611309	IL11	interleukin 11	9615	VGNC:41930	Inparanoid, OMA, EggNOG
Horse	100056037	IL11	interleukin 11	9796	VGNC:18993	Inparanoid, OMA, EggNOG
Cow	100337295	IL11	interleukin 11	9913	VGNC:30108	Inparanoid, OMA, EggNOG
Anole lizard	103279929	il11	interleukin 11	28377		Inparanoid, OMA, EggNOG
Xenopus	105947927	il11	interleukin 11	8364	XB-GENE-479735	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.