JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

IL25

Description	Interleukin-25

Gene and Protein Information

Gene ID	64806
Uniprot Accession IDs	Q9H293 Q2M3F0 Q8IZV3 Q8WXB0 IL-25
Ensembl ID	ENSG00000166090
Symbol	IL17E IL17E
Chromosome	14
Family	Belongs to the IL-17 family.
Sequence	MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	467404	IL25	interleukin 25	9598	VGNC:3404	OMA, EggNOG
Macaque	713943	IL25	interleukin 25	9544		Inparanoid, OMA, EggNOG
Mouse	140806	Il25	interleukin 25	10090	MGI:2155888	Inparanoid, OMA, EggNOG
Rat	501996	Il25	interleukin 25	10116	RGD:1561632	Inparanoid, OMA, EggNOG
Dog	480252	IL25	interleukin 25	9615	VGNC:41975	Inparanoid, OMA, EggNOG
Cow	526816	IL25	interleukin 25	9913	VGNC:30149	Inparanoid, OMA, EggNOG
Pig	100154041	IL25	interleukin 25	9823		Inparanoid, OMA, EggNOG
Opossum		IL25	interleukin 25 [Source:HGNC Symbol;Acc:HGNC:13765]	13616		Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.