Il s'agit d'un magasin de démonstration. Aucune commande ne sera honorée.

IL22

Description Interleukin-22

Gene and Protein Information

Gene ID 50616
Uniprot Accession IDs Q9GZX6 IL-22
Ensembl ID ENSG00000127318
Symbole ILTIF ZCYTO18 TIFa IL-21 IL-22 ILTIF IL-TIF IL-D110 zcyto18 TIFIL-23
Chromosome 12
Family Belongs to the IL-10 family.
Sequence
MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Homologous gene and protein info.
Species Gene ID Gene Symbol Nom Numéro d'identification fiscale Other Gene ID Sources
Chimp 741423 IL22 interleukin 22 9598 VGNC:5429 OMA, EggNOG
Macaque 718047 IL22 interleukin 22 9544 Inparanoid, OMA, EggNOG
Mouse 50929 Il22 interleukin 22 10090 MGI:1355307 OMA, EggNOG
Mouse 116849 Iltifb interleukin 10-related T cell-derived inducible factor beta 10090 MGI:2151139 Inparanoid, OMA
Rat 500836 Il22 interleukin 22 10116 RGD:1561292 Inparanoid, OMA, EggNOG
Dog 481153 IL22 interleukin 22 9615 VGNC:41969 Inparanoid, OMA, EggNOG
Horse 100058976 IL22 interleukin 22 9796 VGNC:19018 Inparanoid, OMA, EggNOG
Cow 507778 IL22 interleukin 22 9913 VGNC:30143 OMA, EggNOG
Pig 595104 IL22 interleukin 22 9823 Inparanoid, OMA, EggNOG
Platypus 100080327 IL22 interleukin 22 9258 Inparanoid, OMA, EggNOG
Chicken 417838 IL22 interleukin 22 9031 CGNC:7522 Inparanoid, OMA, EggNOG
Anole lizard 100556133 il22 interleukin 22 28377 Inparanoid, OMA, EggNOG
Xenopus 100216308 il22 interleukin 22 8364 Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Nom Specification and purity Expression system Protein label Disponibilité Voir les détails

Associated Antibodies

Nom Specifications Species reactivity Application Disponibilité Voir les détails

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Nom Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.