JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

IL21

Description	Interleukin-21

Gene and Protein Information

Gene ID	59067
Uniprot Accession IDs	Q9HBE4 A5J0L4 IL-21
Ensembl ID	ENSG00000138684
Symbol	Za11 IL-21 CVID11
Chromosome	4
Family	Belongs to the IL-15/IL-21 family.
Sequence	MERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	471295	IL21	interleukin 21	9598	VGNC:618	OMA, EggNOG
Macaque	708125	IL21	interleukin 21	9544		Inparanoid, OMA, EggNOG
Mouse	60505	Il21	interleukin 21	10090	MGI:1890474	Inparanoid, OMA, EggNOG
Rat	365769	Il21	interleukin 21	10116	RGD:1307384	Inparanoid, OMA, EggNOG
Dog	442935	IL21	interleukin 21	9615	VGNC:41967	Inparanoid, OMA, EggNOG
Horse	100063803	IL21	interleukin 21	9796	VGNC:19016	Inparanoid, OMA, EggNOG
Cow	378475	IL21	interleukin 21	9913	VGNC:30141	Inparanoid, OMA, EggNOG
Pig	403123	IL21	interleukin 21	9823		Inparanoid, OMA, EggNOG
Chicken	554218	IL21	interleukin 21	9031	CGNC:8978	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.