This is a demo store. No orders will be fulfilled.

IL3RA

Description Interleukin-3 receptor subunit alpha

Gene and Protein Information

Gene ID 3563
Uniprot Accession IDs P26951 A8K3F3 B9VI81 Q5HYQ7 Q5HYQ8 Q9UEH7 IL-3 receptor subunit alpha
Ensembl ID ENSG00000185291
Symbol IL3R IL3R CD123 IL3RX IL3RY IL3RAY hIL-3Ra
Chromosome X
Family Belongs to the type I cytokine receptor family. Type 5 subfamily.
Sequence
MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Mouse 16188 Il3ra interleukin 3 receptor, alpha chain 10090 MGI:96553 Inparanoid, OMA, EggNOG
Rat 246144 Il3ra interleukin 3 receptor subunit alpha 10116 RGD:628728 Inparanoid, OMA, EggNOG
Dog 609293 IL3RA interleukin 3 receptor subunit alpha 9615 Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    defense/immunity protein    /    Interleukin-3 receptor subunit alpha
protein    /    signaling molecule    /    cytokine    /    Interleukin-3 receptor subunit alpha
DTO Classes
protein    /    Signaling    /    Cytokine    /    Interleukin-3 receptor subunit alpha

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.