JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

SUCNR1

Description	Succinate receptor 1

Gene and Protein Information

Gene ID	56670
Uniprot Accession IDs	Q9BXA5 A8K305 Q8TDQ8
Ensembl ID	ENSG00000198829
Symbol	GPR91 GPR91
Chromosome	3
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDLAFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAILISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	738824	SUCNR1	succinate receptor 1	9598	VGNC:12200	OMA, EggNOG
Mouse	84112	Sucnr1	succinate receptor 1	10090	MGI:1934135	Inparanoid, OMA, EggNOG
Rat	408199	Sucnr1	succinate receptor 1	10116	RGD:1303193	Inparanoid, OMA, EggNOG
Dog	485719	SUCNR1	succinate receptor 1	9615	VGNC:46968	Inparanoid, OMA, EggNOG
Horse	100056372	SUCNR1	succinate receptor 1	9796	VGNC:23745	Inparanoid, OMA, EggNOG
Cow	539622	SUCNR1	succinate receptor 1	9913	VGNC:35458	OMA, EggNOG
Pig	100739158	SUCNR1	succinate receptor 1	9823		OMA, EggNOG
Platypus	100083905	SUCNR1	succinate receptor 1	9258		OMA, EggNOG
Chicken	771768	SUCNR1	succinate receptor 1	9031	CGNC:7886	Inparanoid, OMA

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Succinate receptor 1

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.