JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

SSTR2

Description	Somatostatin receptor type 2

Gene and Protein Information

Gene ID	6752
Uniprot Accession IDs	P30874 A8K3Y0 B2R9P7 Q4VBP0 Q96GE0 Q96TF2 Q9BWH1 SS-2-R
Ensembl ID	ENSG00000180616
Chromosome	17
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	695526	SSTR2	somatostatin receptor 2	9544		Inparanoid, OMA, EggNOG
Mouse	20606	Sstr2	somatostatin receptor 2	10090	MGI:98328	Inparanoid, OMA, EggNOG
Rat	54305	Sstr2	somatostatin receptor 2	10116	RGD:3763	Inparanoid, OMA, EggNOG
Dog	403472	SSTR2	somatostatin receptor 2	9615	VGNC:46844	Inparanoid, OMA, EggNOG
Horse	100052744	SSTR2	somatostatin receptor 2	9796	VGNC:23621	Inparanoid, OMA, EggNOG
Cow	282083	SSTR2	somatostatin receptor 2	9913	VGNC:35326	Inparanoid, OMA, EggNOG
Pig		SSTR2	somatostatin receptor 2 [Source:HGNC Symbol;Acc:HGNC:11331]	9823		Inparanoid, OMA, EggNOG
Opossum	100028527	SSTR2	somatostatin receptor 2	13616		Inparanoid, OMA, EggNOG
Platypus	100090283	SSTR2	somatostatin receptor 2	9258		Inparanoid, OMA, EggNOG
Anole lizard	100563000	sstr2	somatostatin receptor 2	28377		Inparanoid, OMA
Xenopus	100496382	sstr2	somatostatin receptor 2	8364	XB-GENE-953419	Inparanoid, OMA

PANTHER Classes
protein / receptor / G-protein coupled receptor / Somatostatin receptor type 2

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Somatostatin receptor type 2

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.