This is a demo store. No orders will be fulfilled.
| Description | E3 ubiquitin-protein ligase TRIM31 |
|---|
Gene and Protein Information
| Gene ID | 11074 |
|---|---|
| Uniprot Accession IDs | Q9BZY9 A6NLX6 A9R9Q4 Q53H52 Q5RI37 Q5SRJ7 Q5SRJ8 Q5SS28 Q96AK4 Q96AP8 Q99579 Q9BZY8 |
| Ensembl ID | ENSG00000204616 |
| Symbol | C6orf13 RNF RNF HCG1 HCGI C6orf13 |
| Chromosome | 6 |
| Family | Belongs to the TRIM/RBCC family. |
| Sequence |
MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFCEVPSS
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 224762 | Trim31 | tripartite motif-containing 31 | 10090 | MGI:2385051 | Inparanoid, OMA |
| Rat | 294208 | Trim31 | tripartite motif-containing 31 | 10116 | RGD:1308607 | Inparanoid, OMA |
| Cow | 517666 | TRIM31 | tripartite motif containing 31 | 9913 | VGNC:36327 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later