JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Account

Settings

Language

྾

Home
Targets(Human)
CD79B

CD79B

Description	B-cell antigen receptor complex-associated protein beta chain

Gene and Protein Information

Gene ID	974
Uniprot Accession IDs	P40259 Q53FS2 Q9BU06
Ensembl ID	ENSG00000007312
Symbol	B29 IGB B29 IGB AGM6
Chromosome	17
Sequence	MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	454773	CD79B	CD79b molecule	9598	VGNC:9180	OMA, EggNOG
Mouse	15985	Cd79b	CD79B antigen	10090	MGI:96431	Inparanoid, OMA, EggNOG
Rat	171055	Cd79b	CD79b molecule	10116	RGD:620012	Inparanoid, OMA, EggNOG
Dog	609449	CD79B	CD79b molecule	9615	VGNC:38974	Inparanoid, OMA, EggNOG
Cow	509801	CD79B	CD79b molecule	9913	VGNC:27047	Inparanoid, OMA, EggNOG
Pig	100511898	CD79B	CD79b molecule	9823		Inparanoid, OMA, EggNOG
Opossum	100026330	CD79B	CD79b molecule	13616		Inparanoid, OMA, EggNOG
Chicken	419940	CD79B	CD79b molecule	9031	CGNC:147	Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    immunoglobulin receptor superfamily    /    B-cell antigen receptor complex-associated protein beta chain
protein    /    receptor    /    defense/immunity protein    /    B-cell antigen receptor complex-associated protein beta chain
protein    /    receptor    /    cytokine receptor    /    B-cell antigen receptor complex-associated protein beta chain

DTO Classes
protein / Receptor / Cytokine receptor / Immunoglobulin receptor superfamily / B-cell antigen receptor complex-associated protein beta chain

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Related active small molecules

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.