JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

MRPL28

Description	39S ribosomal protein L28, mitochondrial

Gene and Protein Information

Gene ID	10573
Uniprot Accession IDs	Q13084 B2RCM4 D3DU46 Q4TT39 Q96S26 Q9BQD8 Q9BR04 L28mt
Ensembl ID	ENSG00000086504
Symbol	MAAT1 p15 MAAT1
Chromosome	16
Family	Belongs to the bacterial ribosomal protein bL28 family.
Sequence	MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	695310	MRPL28	mitochondrial ribosomal protein L28	9544		Inparanoid, OMA, EggNOG
Mouse	68611	Mrpl28	mitochondrial ribosomal protein L28	10090	MGI:1915861	Inparanoid, OMA, EggNOG
Rat	497876	Mrpl28	mitochondrial ribosomal protein L28	10116	RGD:1583741	Inparanoid, OMA, EggNOG
Dog	479897	MRPL28	mitochondrial ribosomal protein L28	9615	VGNC:43389	Inparanoid, OMA, EggNOG
Horse	100066606	MRPL28	mitochondrial ribosomal protein L28	9796	VGNC:20335	Inparanoid, OMA, EggNOG
Cow	508216	MRPL28	mitochondrial ribosomal protein L28	9913	VGNC:31629	Inparanoid, OMA, EggNOG
Pig	100524194	MRPL28	mitochondrial ribosomal protein L28	9823		OMA, EggNOG
Opossum	100016334	MRPL28	mitochondrial ribosomal protein L28	13616		Inparanoid, OMA, EggNOG
Anole lizard	100561478	mrpl28	mitochondrial ribosomal protein L28	28377		Inparanoid, OMA, EggNOG
Xenopus	549205	mrpl28	mitochondrial ribosomal protein L28	8364	XB-GENE-946462	Inparanoid, OMA, EggNOG
Zebrafish	554098	mrpl28	mitochondrial ribosomal protein L28	7955	ZDB-GENE-050522-113	Inparanoid, OMA, EggNOG
C. elegans	173400	mrpl-28	Mitochondrial Ribosomal Protein, Large	6239		Inparanoid, OMA
Fruitfly	33715	mRpL28	mitochondrial ribosomal protein L28	7227	FBgn0031660	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.