This is a demo store. No orders will be fulfilled.
| Description | 39S ribosomal protein L44, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 65080 |
|---|---|
| Uniprot Accession IDs | Q9H9J2 Q53S16 Q6IA62 Q9H821 L44mt |
| Ensembl ID | ENSG00000135900 |
| Symbol | L44MT COXPD16 MRP-L44 |
| Chromosome | 2 |
| Family | Belongs to the ribonuclease III family. Mitochondrion-specific ribosomal protein mL44 subfamily. |
| Sequence |
MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 470663 | MRPL44 | mitochondrial ribosomal protein L44 | 9598 | VGNC:2022 | OMA, EggNOG |
| Macaque | 677716 | MRPL44 | mitochondrial ribosomal protein L44 | 9544 | Inparanoid, OMA | |
| Mouse | 69163 | Mrpl44 | mitochondrial ribosomal protein L44 | 10090 | MGI:1916413 | Inparanoid, OMA, EggNOG |
| Rat | 301552 | Mrpl44 | mitochondrial ribosomal protein L44 | 10116 | RGD:1309556 | Inparanoid, OMA, EggNOG |
| Dog | 100855653 | MRPL44 | mitochondrial ribosomal protein L44 | 9615 | VGNC:43399 | Inparanoid, OMA, EggNOG |
| Horse | 100056697 | MRPL44 | mitochondrial ribosomal protein L44 | 9796 | VGNC:20343 | Inparanoid, OMA, EggNOG |
| Cow | 532389 | MRPL44 | mitochondrial ribosomal protein L44 | 9913 | VGNC:31639 | Inparanoid, OMA, EggNOG |
| Pig | 100153145 | MRPL44 | mitochondrial ribosomal protein L44 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100022395 | MRPL44 | mitochondrial ribosomal protein L44 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 424795 | MRPL44 | mitochondrial ribosomal protein L44 | 9031 | CGNC:2221 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100564313 | mrpl44 | mitochondrial ribosomal protein L44 | 28377 | Inparanoid, OMA | |
| Xenopus | 496841 | mrpl44 | mitochondrial ribosomal protein L44 | 8364 | XB-GENE-1000272 | Inparanoid, OMA, EggNOG |
| Zebrafish | 571210 | mrpl44 | mitochondrial ribosomal protein L44 | 7955 | ZDB-GENE-050913-59 | Inparanoid, OMA, EggNOG |
| Fruitfly | 40656 | mRpL44 | mitochondrial ribosomal protein L44 | 7227 | FBgn0037330 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / endoribonuclease / 39S ribosomal protein L44, mitochondrial
protein / nucleic acid binding / RNA binding protein / 39S ribosomal protein L44, mitochondrial
protein / nucleic acid binding / nuclease / 39S ribosomal protein L44, mitochondrial
protein / nucleic acid binding / endoribonuclease / 39S ribosomal protein L44, mitochondrial
protein / nucleic acid binding / RNA binding protein / 39S ribosomal protein L44, mitochondrial
protein / nucleic acid binding / nuclease / 39S ribosomal protein L44, mitochondrial
DTO Classes
protein / Enzyme / Nuclease / Endoribonuclease / 39S ribosomal protein L44, mitochondrial
protein / Enzyme / Nuclease / Endoribonuclease / 39S ribosomal protein L44, mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later