JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

GJC3

Description	Gap junction gamma-3 protein

Gene and Protein Information

Gene ID	349149
Uniprot Accession IDs	Q8NFK1 A4D296 Q86XI9
Ensembl ID	ENSG00000176402
Symbol	GJE1 CX29 GJE1 CX30.2 CX31.3
Chromosome	7
Family	Belongs to the connexin family. Gamma-type subfamily.
Sequence	MCGRFLRRLLAEESRRSTPVGRLLLPVLLGFRLVLLAASGPGVYGDEQSEFVCHTQQPGCKAACFDAFHPLSPLRFWVFQVILVAVPSALYMGFTLYHVIWHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAALGLQYHLYGFQMPSSFACRREPCLGSITCNLSRPSEKTIFLKTMFGVSGFCLLFTFLELVLLGLGRWWRTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	737656	GJC3	gap junction protein gamma 3	9598	VGNC:14017	OMA, EggNOG
Macaque	100424576	LOC100424576	gap junction gamma-3 protein	9544		OMA, EggNOG
Mouse	118446	Gjc3	gap junction protein, gamma 3	10090	MGI:2153041	Inparanoid, OMA, EggNOG
Rat	288529	Gjc3	gap junction protein, gamma 3	10116	RGD:727930	Inparanoid, OMA, EggNOG
Dog	489850	GJC3	gap junction protein gamma 3	9615	VGNC:54027	Inparanoid, OMA, EggNOG
Horse	100068490	GJC3	gap junction protein gamma 3	9796	VGNC:18361	Inparanoid, OMA, EggNOG
Cow	539991	GJC3	gap junction protein gamma 3	9913	VGNC:29384	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / cell junction protein / gap junction / Gap junction gamma-3 protein

DTO Classes
protein / Cell-cell junction / Gap junction / Gap junction gamma-3 protein

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.