JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

ROM1

Description	Rod outer segment membrane protein 1

Gene and Protein Information

Gene ID	6094
Uniprot Accession IDs	Q03395 B2R978 ROSP1
Ensembl ID	ENSG00000149489
Symbol	TSPAN23 ROM RP7 ROSP1 TSPAN23
Chromosome	11
Family	Belongs to the PRPH2/ROM1 family.
Sequence	MAPVLPLVLPLQPRIRLAQGLWLLSWLLALAGGVILLCSGHLLVQLRHLGTFLAPSCQFPVLPQAALAAGAVALGTGLVGVGASRASLNAALYPPWRGVLGPLLVAGTAGGGGLLVVGLGLALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGSMLAVTFLLQALVLLGLRYLQTALEGLGGVIDAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSEA Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	107966160	ROM1	retinal outer segment membrane protein 1	9598	VGNC:11670	OMA, EggNOG
Mouse	19881	Rom1	rod outer segment membrane protein 1	10090	MGI:97998	Inparanoid, OMA, EggNOG
Rat	309201	Rom1	retinal outer segment membrane protein 1	10116	RGD:1306070	Inparanoid, OMA, EggNOG
Dog	483786	ROM1	retinal outer segment membrane protein 1	9615	VGNC:45690	Inparanoid, OMA, EggNOG
Horse	100063558	ROM1	retinal outer segment membrane protein 1	9796	VGNC:22499	Inparanoid, OMA, EggNOG
Cow	281465	ROM1	retinal outer segment membrane protein 1	9913	VGNC:34084	Inparanoid, OMA, EggNOG
Opossum	100012184	ROM1	retinal outer segment membrane protein 1	13616		Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.