This is a demo store. No orders will be fulfilled.

 
Call +1 (833) 552-7181 or Contact us
Toggle Nav
My Cart
Search
Advanced Search
Menu
Account
Settings
྾

ROMO1

Description Reactive oxygen species modulator 1

Gene and Protein Information

Gene ID 140823
Uniprot Accession IDs P60602 A7M872 E1P5R9 E9KL28 Q3MHD5 Q5QP16 Q9CQ98 Q9H1N2 ROS modulator 1
Ensembl ID ENSG00000125995
Symbol C20orf52 MTGM MTGMP C20orf52 bA353C18.2
Chromosome 20
Family Belongs to the MGR2 family.
Sequence
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 458442 ROMO1 reactive oxygen species modulator 1 9598 VGNC:6315 OMA, EggNOG
Mouse 67067 Romo1 reactive oxygen species modulator 1 10090 MGI:1914317 Inparanoid, OMA, EggNOG
Dog 477215 ROMO1 reactive oxygen species modulator 1 9615 VGNC:45691 Inparanoid, OMA, EggNOG
Horse 100069618 ROMO1 reactive oxygen species modulator 1 9796 VGNC:22500 Inparanoid, OMA, EggNOG
Cow 618530 ROMO1 reactive oxygen species modulator 1 9913 VGNC:34085 Inparanoid, OMA, EggNOG
Pig 100154394 ROMO1 reactive oxygen species modulator 1 9823 Inparanoid, OMA, EggNOG
Opossum 100032520 ROMO1 reactive oxygen species modulator 1 13616 Inparanoid, EggNOG
Chicken 768833 ROMO1 reactive oxygen species modulator 1 9031 CGNC:1076 Inparanoid, OMA
Anole lizard 100564190 romo1 reactive oxygen species modulator 1 28377 Inparanoid, OMA, EggNOG
Xenopus 100125151 romo1 reactive oxygen species modulator 1 8364 XB-GENE-982441 Inparanoid, OMA, EggNOG
Zebrafish 393770 romo1 reactive oxygen species modulator 1 7955 ZDB-GENE-040426-1768 Inparanoid, OMA, EggNOG
C. elegans 174968 romo-1 (Reactive Oxygen species MOdulator) homolog 6239 OMA, EggNOG
Fruitfly 39656 CG6878 CG6878 gene product from transcript CG6878-RA 7227 FBgn0036488 Inparanoid, EggNOG
S.cerevisiae 856006 MGR2 Mgr2p 4932 S000006019 Inparanoid, OMA

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.

Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.